Даведка MediaWiki API
This is an auto-generated MediaWiki Action API documentation page.
General information
Статус: MediaWiki API — сфармаваны і стабільны інтэрфэйс, які актыўна падтрымліваецца і паляпшаецца. І хаця мы імкнемся гэтага ўнікаць, але часам нам трэба ўносіць істотныя зьмены; падпісвайцеся на рассылку mediawiki-api-announce дзеля паведамленьняў пра абнаўленьні.
Памылковыя запыты: калі да API дасылаюцца памылковыя запыты, HTTP-загаловак будзе дасланы з ключом «MediaWiki-API-Error», а потым значэньне загалоўку і код памылкі будуць выстаўленыя на аднолькавае значэньне. Дзеля дадатковай інфармацыі глядзіце API: Памылкі і папярэджаньні.
Тэставаньне: для зручнасьці праверкі API-запытаў, глядзіце Special:ApiSandbox.
Request methods
Action API requests may use GET and POST methods. Prefer using the GET method, which allows requests to be routed to faster replica servers and responses to be cached, unless the length of the URL with parameters would exceed its length limit (commonly 8000 bytes), or a module only accepts POST requests.
Parameters for POST requests may be sent in the query part of the request URL (like in GET requests) and in the POST request body, and mixing both ways in one request is allowed. Certain parameters such as passwords must be sent in the request body. If the same parameter is sent as part of the URL and also in the request body, it must have the same value in both places.
Data types
Input to MediaWiki should be NFC-normalized UTF-8. MediaWiki may attempt to convert other input, but this may cause some operations (such as edits with MD5 checks) to fail.
Parameters that take multiple values are normally submitted with the values separated using the pipe character, e.g. param=value1|value2 or param=value1%7Cvalue2. If a value must contain the pipe character, use U+001F (Unit Separator) as the separator and prefix the value with U+001F, e.g. param=%1Fvalue1%1Fvalue2.
Some parameter types in API requests need further explanation:
- boolean
Boolean parameters work like HTML checkboxes: if the parameter is specified, regardless of value, it is considered true. For a false value, omit the parameter entirely.
- expiry
Expiry values may be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). For no expiry, use infinite, indefinite, infinity or never.
- timestamp
Timestamps may be specified in several formats, see the Timestamp library input formats documented on mediawiki.org for details. ISO 8601 date and time is recommended: 2001-01-15T14:56:00Z. The string now may be used to specify the current time.
Limits
Most API modules can accept up to 50 inputs in multivalue parameters, and can return up to 500 results per query (50 results for slow queries).
For users with the apihighlimits right (Робаты і Адміністратары), the limits are increased to 500 inputs and 5000 results (500 results for slow queries).
Templated parameters
Templated parameters support cases where an API module needs a value for each value of some other parameter. For example, if there were an API module to request fruit, it might have a parameter fruits to specify which fruits are being requested and a templated parameter {fruit}-quantity to specify how many of each fruit to request. An API client that wants 1 apple, 5 bananas, and 20 strawberries could then make a request like fruits=apples|bananas|strawberries&apples-quantity=1&bananas-quantity=5&strawberries-quantity=20.
Main module
- Source: MediaWiki
- License: GPL-2.0-or-later
Specify the action to perform, the format of the response, and options that apply to all API modules.
- action
Дзеяньне для выкананьня.
- abusefiltercheckmatch
- Праверце, ці адпавядае Фільтру злоўжываньняў набор зьменных, рэдагаваньне ці запратакаляваная падзея Фільтру.
- abusefilterchecksyntax
- Праверыць сынтаксыс фільтру злоўжываньняў.
- abusefilterevalexpression
- Ацэньвае значэньне выразу фільтара злоўжываньняў.
- abusefilterunblockautopromote
- Разблякаваць карыстальніка ад атрыманьня аўтаматычных рэклямных акцыяў праз наступствы abusefilter.
- abuselogprivatedetails
- Прагляд прыватных зьвестак пра запіс журналу злоўжываньняў.
- acquiretempusername
- Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
- antispoof
- Праверка імені ўдзельніка паводле крытэраў нармалізацыі AntiSpoof.
- block
- Блякаваньне ўдзельніка.
- centralauthtoken
- Fetch a centralauthtoken for making an authenticated request to an attached wiki.
- centralnoticecdncacheupdatebanner
- Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- Зьмена зьвестак аўтэнтыфікацыі для цяперашняга ўдзельніка.
- changecontentmodel
- Change the content model of a page
- checktoken
- Праверыць карэктнасьць токену з action=query&meta=tokens.
- clearhasmsg
- Ачышчае сьцяг
hasmsgдля актуальнага карыстальніка. - clientlogin
- Увайсьці ў вікі з дапамогай інтэрактыўнага струменя.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- Атрымаць розьніцу паміж 2 старонкамі.
- createaccount
- Стварэньне новага рахунку ўдзельніка.
- createlocalaccount
- Прымусовае стварэньне лякальнага рахунку. Цэнтралізаваны рахунак ўжо мусіць існаваць.
- cxdelete
- Delete a draft translation created using the Content Translation extension.
- cxtoken
- Get JWT tokens to authenticate with cxserver.
- delete
- Выдаліць старонку.
- deleteglobalaccount
- Delete a global user.
- discussiontoolsedit
- Апублікаваць паведамленне на старонцы размовы.
- discussiontoolsfindcomment
- Find a comment by its ID or name.
- discussiontoolsgetsubscriptions
- Атрымаць станы падпіскі на зададзеныя тэмы.
- discussiontoolssubscribe
- Падпісацца (або адпісацца), каб атрымліваць апавяшчэнні па тэме.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Пазначыць абвесткі для цяперашняга карыстальніка прачытанымі.
- echomarkseen
- Пазначыць апавяшчэнні як прагледжаныя для бягучага ўдзельніка.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Ствараць і правіць старонкі.
- editmassmessagelist
- Edit a mass message delivery list.
- emailuser
- Email a user.
- expandtemplates
- Expands all templates within wikitext.
- featuredfeed
- Returns a featured content feed.
- feedcontributions
- Returns a user's contributions feed.
- feedrecentchanges
- Returns a recent changes feed.
- feedwatchlist
- Returns a watchlist feed.
- filerevert
- Revert a file to an old version.
- globalblock
- Globally block or unblock a user.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- Change global preferences of the current user.
- globaluserrights
- Add/remove a user to/from global groups.
- growthmanagementorlist
- Manage information in the structured mentor list (usually stored in MediaWiki:GrowthMentors.json). This module can be used by both current and future mentors (to add themselves or change their details) and administrators (for all users).
- growthmentordashboardupdatedata
- Schedule an extraordinary update of the mentee overview module in the mentor dashboard. You can only schedule one update per two hours for performance reasons.
- growthsetmenteestatus
- Set mentee's status (allows mentees to enable/disable mentorship module, or to opt-out entirely, which deletes the mentee/mentor relationship)
- growthsetmentor
- Set user's mentor. Change will be publicly logged.
- growthstarmentee
- Mark or unmark a mentee as starred by current user (stored privately and not logged)
- help
- Display help for the specified modules.
- homepagequestionstore
- Obtain formatted questions posted via homepage modules
- imagerotate
- This module has been disabled.
- import
- Import a page from another wiki, or from an XML file.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Пошук назваў моваў будзь-якім альфабэтам.
- linkaccount
- Link an account from a third-party provider to the current user.
- login
- Log in and get authentication cookies.
- logout
- Log out and clear session data.
- managetags
- Perform management tasks relating to change tags.
- massmessage
- Send a message to a list of pages.
- mergehistory
- Merge page histories.
- move
- Перанесьці старонку
- opensearch
- Search the wiki using the OpenSearch protocol.
- options
- Change preferences of the current user.
- paraminfo
- Obtain information about API modules.
- parse
- Parses content and returns parser output.
- patrol
- Patrol a page or revision.
- protect
- Change the protection level of a page.
- purge
- Purge the cache for the given titles.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Remove authentication data for the current user.
- resetpassword
- Send a password reset email to a user.
- revisiondelete
- Delete and undelete revisions.
- rollback
- Undo the last edit to the page.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- setglobalaccountstatus
- Hide or lock (or unhide or unlock) a global user account.
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Change the language of a page.
- shortenurl
- Скараціць доўгі URL-адрас у больш кароткі.
- sitematrix
- Get Wikimedia sites list.
- spamblacklist
- Validate one or more URLs against the spam block list.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- Allows admins to strike or unstrike a vote.
- sxdelete
- Delete the draft section translation and its parallel corpora from database.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- Fetch data stored by the TemplateData extension.
- thank
- Send a thank-you notification to an editor.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- torblock
- Праверыць, ці не заблакаваны IP-адрас Tor.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- unblock
- Unblock a user.
- undelete
- Undelete revisions of a deleted page.
- unlinkaccount
- Remove a linked third-party account from the current user.
- upload
- Upload a file, or get the status of pending uploads.
- userrights
- Change a user's group membership.
- validatepassword
- Validate a password against the wiki's password policies.
- watch
- Add or remove pages from the current user's watchlist.
- webapp-manifest
- Вяртае маніфест вэб-прыкладання.
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- bouncehandler
- Internal. Receive a bounce email and process it to handle the failing recipient.
- categorytree
- Internal. Унутраны модуль для пашырэньня структуры катэгорыяў.
- chartinfo
- Internal. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- Internal. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Internal. Dump of CirrusSearch configuration.
- cirrus-profiles-dump
- Internal. Dump of CirrusSearch profiles for this wiki.
- cirrus-schema-dump
- Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
- codemirror-validate
- Internal. Check for validation errors in the given content
- collection
- Internal. API module for performing various operations on a wiki user's collection.
- cspreport
- Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- cxcheckunreviewed
- Internal. Check if any fast, unreviewed translation has been published recently for the current user.
- cxfavoritesuggestions
- Internal. Add or remove a favorite suggestion to the current user's list.
- cxpublish
- Internal. Захавайце старонку, створаную з дапамогай пашырэння Content Translation.
- cxpublishsection
- Internal. Save a section created using the Content Translation extension's section translation feature.
- cxsave
- Internal. This module allows to save draft translations by section to save bandwidth and to collect parallel corpora.
- cxsplit
- Internal. Create and save a section translation to database, for every translated section of the given article translation
- discussiontoolscompare
- Internal. Атрымаць інфармацыю пра змены каментароў паміж двума версіямі старонак.
- discussiontoolspageinfo
- Internal. Вяртае метададзеныя, неабходныя для ініцыялізацыі інструментаў размоў.
- discussiontoolspreview
- Internal. Перадпрагляд паведамлення на старонцы размоў.
- echopushsubscriptions
- Internal. Manage push subscriptions for the current user.
- editcheckreferenceurl
- Internal. Check the status of a URL for use as a reference.
- fancycaptchareload
- Internal. Атрымаць новую FancyCaptcha.
- growthinvalidateimagerecommendation
- Internal. Invalidate an image recommendation.
- growthinvalidatepersonalizedpraisesuggestion
- Internal. Invalidates a suggestion of a praiseworthy mentee in the Personalized praise module on the Mentor dashboard
- growthinvalidaterevisetonerecommendation
- Internal. Drop a 'Revise Tone' recommendation for a given page.
- helppanelquestionposter
- Internal. Апрацоўка пытаньняў, разьмешчаных праз панэль дапамогі, для цяперашняга ўдзельніка.
- jsondata
- Internal. Retrieve localized JSON data.
- jsontransform
- Internal. Retrieve JSON data transformed by a Lua function.
- parser-migration
- Internal. Разабраць старонку з двума рознымі наладамі аналізатара.
- readinglists
- Internal. Reading list write operations.
- sanitize-mapdata
- Internal. Performs data validation for Kartographer extension
- scribunto-console
- Internal. Internal module for servicing XHR requests from the Scribunto console.
- securepollauth
- Internal. Allows a remote wiki to authenticate users before granting access to vote in the election.
- stashedit
- Internal. Prepare an edit in shared cache.
- sxsave
- Internal. Save the draft section translation and store the parallel corpora
- timedtext
- Internal. Provides timed text content for usage by <track> elements
- ulslocalization
- Internal. Атрымаць лякалізацыю ULS на пададзенай мове.
- ulssetlang
- Internal. Update user's preferred interface language.
- visualeditor
- Internal. Returns HTML5 for a page from the Parsoid service.
- visualeditoredit
- Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- wikimediaeventsblockededit
- Internal. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- One of the following values: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, cxdelete, cxtoken, delete, deleteglobalaccount, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, growthmanagementorlist, growthmentordashboardupdatedata, growthsetmenteestatus, growthsetmentor, growthstarmentee, help, homepagequestionstore, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, massmessage, mergehistory, move, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, streamconfigs, strikevote, sxdelete, tag, templatedata, thank, titleblacklist, torblock, transcodereset, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, codemirror-validate, collection, cspreport, cxcheckunreviewed, cxfavoritesuggestions, cxpublish, cxpublishsection, cxsave, cxsplit, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, echopushsubscriptions, editcheckreferenceurl, fancycaptchareload, growthinvalidateimagerecommendation, growthinvalidatepersonalizedpraisesuggestion, growthinvalidaterevisetonerecommendation, helppanelquestionposter, jsondata, jsontransform, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, sxsave, timedtext, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
- Default: help
- format
Фармат вываду.
- json
- Output data in JSON format.
- jsonfm
- Output data in JSON format (pretty-print in HTML).
- none
- Output nothing.
- php
- Output data in serialized PHP format.
- phpfm
- Output data in serialized PHP format (pretty-print in HTML).
- rawfm
- Output data, including debugging elements, in JSON format (pretty-print in HTML).
- xml
- Output data in XML format.
- xmlfm
- Output data in XML format (pretty-print in HTML).
- One of the following values: json, jsonfm, none, php, phpfm, rawfm, xml, xmlfm
- Default: jsonfm
- maxlag
Максымальная затрымка можа ўжывацца, калі MediaWiki ўсталяваная ў клястэр з рэплікаванай базай зьвестак. Дзеля захаваньня дзеяньняў, якія выклікаюць затрымку рэплікацыі, гэты парамэтар можа прымусіць кліента чакаць, пакуль затрымка рэплікацыі меншая за яго значэньне. У выпадку доўгай затрымкі, вяртаецца код памылкі maxlag з паведамленьнем накшталт Чаканьне $host: $lag сэкундаў затрымкі.
Глядзіце Інструкцыя:Парамэтар maxlag дзеля дадатковай інфармацыі.- Type: integer
- smaxage
Выстаўце HTTP-загаловак кантролю кэшу
s-maxageна зададзеную колькасьць сэкундаў. Памылкі ніколі не кэшуюцца.- Type: integer
- The value must be no less than 0.
- Default: 0
- maxage
Выстаўляе HTTP-загаловак кантролю кэшу
max-ageна зададзеную колькасьць сэкундаў. Памылкі ніколі не кэшуюцца.- Type: integer
- The value must be no less than 0.
- Default: 0
- assert
Упэўніцеся, што ўдзельнік увайшоў у сыстэму (магчыма, як часовы карыстальнік), калі зададзена user, не ўвайшоў, калі зададзена anon, або мае правы робата, калі зададзена bot.
- One of the following values: anon, bot, user
- assertuser
Праверыць, што імя цяперашняга ўдзельніка супадае з зададзеным.
- Тып: карыстач, кожным з імя карыстача і Часовы карыстальнік
- requestid
Кожнае значэньне, пададзенае тут, будзе далучанае ў адказ. Можа быць выкарыстанае для адрозьненьня запытаў.
- servedby
Уключае ў вынік назву сэрвэра, які апрацаваў запыт.
- Type: boolean (details)
- curtimestamp
Уключае ў вынік пазнаку актуальнага часу.
- Type: boolean (details)
- responselanginfo
Уключыць мовы, выкарыстаныя для uselang і errorlang, у вынік.
- Type: boolean (details)
- origin
Пры звароце да API з дапамогай міждамэннага AJAX-запыту (CORS), выстаўце парамэтру значэньне зыходнага дамэну. Ён мусіць быць уключаны ў кожны папярэдні запыт і такім чынам мусіць быць часткай URI-запыту (ня цела POST).
Для аўтэнтыфікаваных запытаў ён мусіць супадаць з адной з крыніц у загалоўку
Origin, павінна быць зададзена нешта накшталт https://en.wikipedia.org або https://meta.wikimedia.org. Калі парамэтар не супадае з загалоўкамOrigin, будзе вернуты адказ з кодам памылкі 403. Калі парамэтар супадае з загалоўкамOriginі крыніца дазволеная, будуць выстаўленыя загалоўкіAccess-Control-Allow-OriginіAccess-Control-Allow-Credentials.Для неаўтэнтыфікаваных запытаў выстаўце значэньне *. Гэта прывядзе да выстаўленьня загалоўку
Access-Control-Allow-Origin, алеAccess-Control-Allow-Credentialsбудзе мець значэньнеfalseі ўсе зьвесткі пра карыстальніка будуць абмежаваныя.- crossorigin
Пры доступе да API з дапамогай кросдамэнавых запытаў AJAX request (CORS) і сэсійнага пастаўніка, абароненага ад кросбачынавых атакаў падробкі запытаў (CSRF, прыкладам, OAuth), дзеля аўтэнтыфікацыі запыту (т. б. бяз выхаду з сыстэмы) карыстайцеся гэтым замест
origin=*. Гэта трэба ўключаць у любыя перадпалётныя запыты, а значыць, у склад запыту URI (ня ў цела POST).Зьвярніце ўвагу, што большасьць сэсійных пастаўнікоў, у тым ліку стандартныя сэсіі на базе маркёраў, не падтрымліваюць аўтэнтыфікаваныя CORS і ня могуць выкарыстоўвацца з гэтым парамэтрам.
- Type: boolean (details)
- uselang
Мова для выкарыстаньня ў перакладах паведамленьняў. action=query&meta=siteinfo&siprop=languages з siprop=languages вяртае сьпіс кодаў мовы. Вы можаце пазначыць user, каб ужываць налады мовы цяперашняга карыстальніка, або пазначыць content, каб ужываць мову зьместу гэтай вікі.
- Default: user
- variant
Варыянт мовы. Працуе толькі ў выпадку, калі базавая мова падтрымлівае пераўтварэньне варыянтаў.
- errorformat
Фармат для вываду тэксту папярэджаньняў і памылак
- plaintext
- Вікітэкст з выдаленымі HTML-цэтлікамі і замененымі існасьцямі.
- wikitext
- Неразабраны вікітэкст.
- html
- HTML
- raw
- Ключ паведамленьня і парамэтры.
- none
- Бяз тэкставага вываду, толькі коды памылак.
- bc
- Фармат, які выкарыстоўваўся да MediaWiki 1.29. errorlang і errorsuselocal ігнаруюцца.
- One of the following values: bc, html, none, plaintext, raw, wikitext
- Default: bc
- errorlang
Мова для выкарыстаньня ў папярэджаньнях і памылках. action=query&meta=siteinfo&siprop=languages з siprop=languages вяртае сьпіс кодаў моваў. Пазначце content для выкарыстаньня мовы зьместу гэтай вікі, ці пазначце uselang для выкарыстаньня таго ж значэньня, што і ў парамэтры uselang.
- Default: uselang
- errorsuselocal
Калі зададзена, тэксты памылак будуць выкарыстоўваць лякальна-наладжаныя паведамленьні з прасторы назваў MediaWiki.
- Type: boolean (details)
- centralauthtoken
When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after 60 seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).
On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.
- Help for the main module.
- api.php?action=help [open in sandbox]
- Уся дапамога на адной старонцы.
- api.php?action=help&recursivesubmodules=1&toc [open in sandbox]
Credits
API developers:
- Yuri Astrakhan (creator, lead developer Sep 2006–Sep 2007)
- Roan Kattouw (lead developer Sep 2007–2009)
- Victor Vasiliev
- Bryan Tong Minh
- Sam Reed
- Brad Jorsch (lead developer 2013–2020)
Please send your comments, suggestions and questions to mediawiki-api@lists.wikimedia.org or file a bug report at https://phabricator.wikimedia.org/.