راهنمای واسط برنامهنویسی کاربردی مدیاویکی
این یک صفحهٔ مستندات برای واسط برنامهنویسی کاربردی مدیاویکی است که بهطور خودکار ایجاد شده است.
مستندات و نمونهها: https://www.mediawiki.org/wiki/Special:MyLanguage/API:Main_page
پودمان اصلی
- منبع: MediaWiki
- مجوز: GPL-2.0-or-later
وضعیت: تمام ویژگیهایی که در این صفحه نمایش یافتهاند باید کار بکنند، ولی رابط برنامهنویسی کاربردی کماکان در حال توسعه است، و ممکن است در هر زمان تغییر بکند. به عضویت فهرست پست الکترونیکی mediawiki-api-announce در بیایید تا از تغییرات باخبر شوید.
درخواستهای معیوب: وقتی درخواستهای معیوب به رابط برنامهنویسی کاربردی فرستاده شوند، یک سرایند اچتیتیپی با کلید «MediaWiki-API-Erorr» فرستاده میشود و بعد هم مقدار سرایند و هم کد خطای بازگردانده شده هر دو به یک مقدار نسبت داده میشوند. برای اطلاعات بیشتر API: Errors and warnings را ببینید.
آزمایش: برای انجام درخواستهای API آزمایشی Special:ApiSandbox را ببینید.
- action
کدام عملیات را انجام دهد.
- abusefiltercheckmatch
- بررسی کنید تا ببینید پالایهٔ ویرایش با مجموعهای از متغیرها، یک ویرایش، یا یک رویداد سیاههٔ پالایهٔ ویرایش کاربر مطابق است یا خیر.
- abusefilterchecksyntax
- نحو یک پالایهٔ ویرایش را بررسی کنید.
- abusefilterevalexpression
- یک عبارت پالایهٔ ویرایش را ارزشیابی میکند.
- abusefilterunblockautopromote
- باز کردن یک کاربر از ارتقاء خودکار بر پایهٔ نتیجهٔ پالایهٔ ویرایش.
- abuselogprivatedetails
- مشاهدهٔ جزئیات خصوصی یک مدخل سیاههٔ ویرایش.
- acquiretempusername
- Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
- antispoof
- بررسی یک نام کاربری به وسیلهٔ آزمونهای بهنجارسازی عبارات سردرگمکننده
- block
- بستن یک کاربر.
- centralauthtoken
- دریافت یک بلیط ورود متمرکز برای ارسال یک درخواست تأییدشده به یک ویکی متصل شده.
- centralnoticecdncacheupdatebanner
- درخواست پاکسازی محتوای بنر ذخیرهشده در حافظۀ نهان CDN (پیشانه) برای کاربران ناشناس، برای بنر و زبان مورد درخواست
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- تغییر دادۀ اصالتسنجی برای کاربر کنونی
- changecontentmodel
- تغییر مدل محتوای یک صفحه
- checktoken
- بررسی اعتبار بلیط از action=query&meta=tokens.
- clearhasmsg
- پرچم
hasmsgرا برای کاربر جاری پاک کن. - clientlogin
- Log in to the wiki using the interactive flow.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- تفاوت بین ۲ صفحه را بیابید.
- createaccount
- ایجاد یک حساب تازه کاربری
- createlocalaccount
- ایجاد اجباری یک حساب محلی. حساب مرکزی باید موجود باشد.
- cxdelete
- Delete a draft translation created using the Content Translation extension.
- cxtoken
- Get JWT tokens to authenticate with cxserver.
- delete
- حذف صفحه
- deleteglobalaccount
- حذف یک کاربر سراسری
- discussiontoolsedit
- فرستادن یک نظر در یک صفحهٔ بحث.
- discussiontoolsfindcomment
- Find a comment by its ID or name.
- discussiontoolsgetsubscriptions
- دریافت وضعیت اشتراک مبحثهای مشخصشده.
- discussiontoolssubscribe
- اشتراک (یا لغو اشتراک) برای دریافت آگاهسازیها دربارهٔ یک مبحث.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- علامت گذاری آگاهسازیها به عنوان خوانده شده برای کاربر کنونی
- echomarkseen
- علامت گذاری آگاهسازیها به عنوان دیده شده برای کاربر کنونی.
- echomute
- بیصدا یا باصدا کردن اعلانها از کاربران یا صفحههای خاص.
- edit
- ایجاد و ویرایش صفحه
- editmassmessagelist
- ویرایش فهرست گیرندگان پیام انبوه.
- emailuser
- ایمیل به کاربر
- expandtemplates
- گسترش همه الگوها در ویکی نبشته
- featuredfeed
- یک فید از محتوای برگزیده را باز میگرداند..
- feedcontributions
- خوراک مشارکتهای یک کاربر را برمیگرداند.
- feedrecentchanges
- خوراک تغییرات اخیر را برمیگرداند.
- feedwatchlist
- برگرداندن خوراک فهرست پیگیری.
- filerevert
- واگردانی فایل به یک نسخه قدیمی
- globalblock
- بستن یا باز کردن یک کاربر بهطور سراسری.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- تغییر ترجیحات سراسری کاربر کنونی.
- globaluserrights
- افزودن/حذف یک حساب به/از یک گروه سراسری.
- growthmanagementorlist
- Manage information in the structured mentor list (usually stored in MediaWiki:GrowthMentors.json). This module can be used by both current and future mentors (to add themselves or change their details) and administrators (for all users).
- growthmentordashboardupdatedata
- Schedule an extraordinary update of the mentee overview module in the mentor dashboard. You can only schedule one update per two hours for performance reasons.
- growthsetmenteestatus
- Set mentee's status (allows mentees to enable/disable mentorship module, or to opt-out entirely, which deletes the mentee/mentor relationship)
- growthsetmentor
- مربی کاربر را مشخص کنید. تغییر به طور عمومی ثبت خواهد شد.
- growthstarmentee
- Mark or unmark a mentee as starred by current user (stored privately and not logged)
- help
- نمایش راهنمای پودمانهای مشخصشده.
- homepagequestionstore
- تهیهٔ سوالات قالببندی شده ارسالشده از طریق ماژولهای صفحهٔ اصلی
- imagerotate
- این پودمان غیرفعال شده است.
- import
- Import a page from another wiki, or from an XML file.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Search for language names in any script.
- linkaccount
- Link an account from a third-party provider to the current user.
- login
- Log in and get authentication cookies.
- logout
- خروج به همراه پاک نمودن اطلاعات این نشست
- managetags
- Perform management tasks relating to change tags.
- massmessage
- فرستادن یک پیام به فهرستی از صفحهها.
- mergehistory
- ادغام تاریخچههای صفحه
- move
- انتقال صفحه
- opensearch
- جستجو در ویکی بااستفاده از پروتکل اوپنسرچ.
- options
- تغییر ترجیحات کاربر جاری
- paraminfo
- Obtain information about API modules.
- parse
- Parses content and returns parser output.
- patrol
- گشتزنی یک صفحه یا نسخهٔ ویرایشی.
- protect
- تغییر سطح محافظت صفحه
- purge
- Purge the cache for the given titles.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Remove authentication data for the current user.
- resetpassword
- Send a password reset email to a user.
- revisiondelete
- Delete and undelete revisions.
- rollback
- Undo the last edit to the page.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- setglobalaccountstatus
- تنظیم وضعیت یک حساب سراسری.
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Change the language of a page.
- shortenurl
- کوتاه کردن یک نشانی اینترنتی بلند به یک نشانی اینترنتی کوتاه
- sitematrix
- گرفتن فهرست وبگاههای ویکیمدیا
- spamblacklist
- Validate one or more URLs against the spam block list.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- اجازه میدهد که مدیران رأیی را خط بزنند یا از خطخوردگی به درش آورند.
- sxdelete
- Delete the draft section translation and its parallel corpora from database.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- واکشی دادههای ذخیرهشده توسط افزونهٔ الگوداده.
- thank
- پیام تشکری به یک ویرایشگر ارسال کنید.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- torblock
- Check if an IP address is blocked as a Tor exit node.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- unblock
- بازکردن کاربر.
- undelete
- احیای نسخههای یک صفحهٔ حذفشده.
- unlinkaccount
- Remove a linked third-party account from the current user.
- upload
- بارگذاری یک پرونده یا دریافت وضعیت بارگذاریهای در انتظار.
- userrights
- تغییر گروهی که کاربر در آن عضو است.
- validatepassword
- Validate a password against the wiki's password policies.
- watch
- Add or remove pages from the current user's watchlist.
- webapp-manifest
- بازگشت بیانیهٔ اپلیکیشن وب
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- bouncehandler
- داخلی Receive a bounce email and process it to handle the failing recipient.
- categorytree
- داخلی پودمان داخلی برای افزونهٔ درخت رده
- chartinfo
- داخلی Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- داخلی Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- داخلی دامپ تنظیمات سیروسسرچ
- cirrus-profiles-dump
- داخلی Dump of CirrusSearch profiles for this wiki.
- cirrus-schema-dump
- داخلی Dump of CirrusSearch schema (settings and mappings) for this wiki.
- codemirror-validate
- داخلی Check for validation errors in the given content
- collection
- داخلی API module for performing various operations on a wiki user's collection.
- cspreport
- داخلی Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- cxcheckunreviewed
- داخلی Check if any fast, unreviewed translation has been published recently for the current user.
- cxfavoritesuggestions
- داخلی Add or remove a favorite suggestion to the current user's list.
- cxpublish
- داخلی ذخیرهٔ یک صفحهٔ ایجادشده با استفاده از افزودهٔ ترجمهٔ محتوا
- cxpublishsection
- داخلی ذخیره صفحهٔ ایجادشده با استفاده از ویژگی ترجمهٔ بخش افزونهٔ ترجمهٔ محتوا.
- cxsave
- داخلی This module allows to save draft translations by section to save bandwidth and to collect parallel corpora.
- cxsplit
- داخلی Create and save a section translation to database, for every translated section of the given article translation
- discussiontoolscompare
- داخلی Get information about comment changes between two page revisions.
- discussiontoolspageinfo
- داخلی فرادادهٔ مورد نیاز برای راهاندازی ابزارهای گفتوگو را برمیگرداند
- discussiontoolspreview
- داخلی پیشنمایش یک پیام در یک صفحهٔ گفتگو
- echopushsubscriptions
- داخلی Manage push subscriptions for the current user.
- editcheckreferenceurl
- داخلی Check the status of a URL for use as a reference.
- fancycaptchareload
- داخلی کپچای جدید دریافت کن.
- growthinvalidateimagerecommendation
- داخلی Invalidate an image recommendation.
- growthinvalidatepersonalizedpraisesuggestion
- داخلی Invalidates a suggestion of a praiseworthy mentee in the Personalized praise module on the Mentor dashboard
- growthinvalidaterevisetonerecommendation
- داخلی Drop a 'Revise Tone' recommendation for a given page.
- helppanelquestionposter
- داخلی مدیریت ارسال سوالهای میز کمک برای کاربر کنونی.
- jsondata
- داخلی Retrieve localized JSON data.
- jsontransform
- داخلی Retrieve JSON data transformed by a Lua function.
- parser-migration
- داخلی تجزیه صفحه با دو تظیمات متفاوت
- readinglists
- داخلی Reading list write operations.
- sanitize-mapdata
- داخلی Performs data validation for Kartographer extension
- scribunto-console
- داخلی Internal module for servicing XHR requests from the Scribunto console.
- securepollauth
- داخلی به یک ویکی راهدور اجازه میدهد تا پیش از اعطای دسترسی برای رأیدادن در انتخابات، کاربران را تأیید هویت کند
- stashedit
- داخلی Prepare an edit in shared cache.
- sxsave
- داخلی Save the draft section translation and store the parallel corpora
- timedtext
- داخلی Provides timed text content for usage by <track> elements
- ulslocalization
- داخلی Get the localization of ULS in the given language.
- ulssetlang
- داخلی Update user's preferred interface language.
- visualeditor
- داخلی HTML5 یک صفحه را از خدمت پارسوید برمیگرداند.
- visualeditoredit
- داخلی ذخیره صفحه HTML5 به مدیاویکی (تبدیل به متن ویکی با سرویس پارسوید)
- wikimediaeventsblockededit
- داخلی Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- داخلی Log edit diff when hCaptcha challenge is shown but edit is incomplete
- یکی از مقدارهای زیر: abusefiltercheckmatch، abusefilterchecksyntax، abusefilterevalexpression، abusefilterunblockautopromote، abuselogprivatedetails، acquiretempusername، antispoof، block، centralauthtoken، centralnoticecdncacheupdatebanner، centralnoticechoicedata، centralnoticequerycampaign، changeauthenticationdata، changecontentmodel، checktoken، clearhasmsg، clientlogin، communityconfigurationedit، compare، createaccount، createlocalaccount، cxdelete، cxtoken، delete، deleteglobalaccount، discussiontoolsedit، discussiontoolsfindcomment، discussiontoolsgetsubscriptions، discussiontoolssubscribe، discussiontoolsthank، echocreateevent، echomarkread، echomarkseen، echomute، edit، editmassmessagelist، emailuser، expandtemplates، featuredfeed، feedcontributions، feedrecentchanges، feedwatchlist، filerevert، globalblock، globalpreferenceoverrides، globalpreferences، globaluserrights، growthmanagementorlist، growthmentordashboardupdatedata، growthsetmenteestatus، growthsetmentor، growthstarmentee، help، homepagequestionstore، imagerotate، import، jsonconfig، languagesearch، linkaccount، login، logout، managetags، massmessage، mergehistory، move، opensearch، options، paraminfo، parse، patrol، protect، purge، query، removeauthenticationdata، resetpassword، revisiondelete، rollback، rsd، setglobalaccountstatus، setnotificationtimestamp، setpagelanguage، shortenurl، sitematrix، spamblacklist، streamconfigs، strikevote، sxdelete، tag، templatedata، thank، titleblacklist، torblock، transcodereset، unblock، undelete، unlinkaccount، upload، userrights، validatepassword، watch، webapp-manifest، webauthn، bouncehandler، categorytree، chartinfo، cirrus-check-sanity، cirrus-config-dump، cirrus-profiles-dump، cirrus-schema-dump، codemirror-validate، collection، cspreport، cxcheckunreviewed، cxfavoritesuggestions، cxpublish، cxpublishsection، cxsave، cxsplit، discussiontoolscompare، discussiontoolspageinfo، discussiontoolspreview، echopushsubscriptions، editcheckreferenceurl، fancycaptchareload، growthinvalidateimagerecommendation، growthinvalidatepersonalizedpraisesuggestion، growthinvalidaterevisetonerecommendation، helppanelquestionposter، jsondata، jsontransform، parser-migration، readinglists، sanitize-mapdata، scribunto-console، securepollauth، stashedit، sxsave، timedtext، ulslocalization، ulssetlang، visualeditor، visualeditoredit، wikimediaeventsblockededit، wikimediaeventshcaptchaeditattempt
- پیشفرض: help
- format
فرمت خروجی.
- json
- خروجی داده در قالب جیسان.
- jsonfm
- خروجی داده در قالب جیسان (چاپ زیبا در اچتیامال).
- none
- بیرونریزی هیچ.
- php
- Output data in serialized PHP format.
- phpfm
- Output data in serialized PHP format (pretty-print in HTML).
- rawfm
- Output data, including debugging elements, in JSON format (pretty-print in HTML).
- xml
- Output data in XML format.
- xmlfm
- Output data in XML format (pretty-print in HTML).
- یکی از مقدارهای زیر: json، jsonfm، none، php، phpfm، rawfm، xml، xmlfm
- پیشفرض: jsonfm
- maxlag
Maximum lag can be used when MediaWiki is installed on a database replicated cluster. To save actions causing any more site replication lag, this parameter can make the client wait until the replication lag is less than the specified value. In case of excessive lag, error code maxlag is returned with a message like Waiting for $host: $lag seconds lagged.
See Manual: Maxlag parameter for more information.- نوع: عدد صحیح
- smaxage
تنظيم
s-maxageسرآیند کنترل حافضهٔ نهان HTTP بر اين تعداد ثانيهها. خطاها هرگز در حافظه نهان نمیشوند.- نوع: عدد صحیح
- The value must be no less than ۰.
- پیشفرض: 0
- maxage
تنظيم
s-maxageسرآیند کنترل حافضهٔ نهان HTTP بر اين تعداد ثانيهها. خطاها هرگز در حافظه نهان نمیشوند.- نوع: عدد صحیح
- The value must be no less than ۰.
- پیشفرض: 0
- assert
تأیید این که کاربر وارد سامانه شده با تنظیم روی user، وارد سامانه نشده در صورت تنظیم روی anon یا دارای پرچم ربات در صورتی تنظیم روی bot.
- یکی از مقدارهای زیر: anon، bot، user
- assertuser
تأیید این که کاربر کنونی همان کاربر نامدار است.
- نوع: کاربر، توسط هریک از نام کاربری و حساب کاربری موقت
- requestid
هر مقداری که در اینجا وارد شود در پاسخ گنجانده میشود. ممکن است برای تمايز بين درخواستها بکار رود.
- servedby
نام ميزبانی که درخواست را سرويس داده در نتايج گنجانده شود.
- نوع: بولی (جزئیات)
- curtimestamp
برچسب زمان کنونی را در نتیجه قرار دهید.
- نوع: بولی (جزئیات)
- responselanginfo
گنجاندن زبان مورد استفاده برای userlang و errorlang در نتیجه.
- نوع: بولی (جزئیات)
- origin
When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URI (not the POST body).
For authenticated requests, this must match one of the origins in the
Originheader exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match theOriginheader, a 403 response will be returned. If this parameter matches theOriginheader and the origin is allowed, theAccess-Control-Allow-OriginandAccess-Control-Allow-Credentialsheaders will be set.For non-authenticated requests, specify the value *. This will cause the
Access-Control-Allow-Originheader to be set, butAccess-Control-Allow-Credentialswill befalseand all user-specific data will be restricted.- crossorigin
When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of
origin=*to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URI (not the POST body).Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.
- نوع: بولی (جزئیات)
- uselang
Language to use for message translations. action=query&meta=siteinfo&siprop=languages returns a list of language codes. You can specify user to use the current user's language preference or content to use this wiki's content language.
- پیشفرض: user
- variant
گونهٔ زبان. تنها در صورتی کار میکند که زبان مبنا از تبدیل گونه پشتیبانی کند.
- errorformat
قالبی بهمنظور استفاده برای متن خروجی هشدار و خطا
- plaintext
- ویکیمتن با برچسبهای اچتیامال حذفشده و موجودیتهای جایگزینشده.
- wikitext
- ویکیمتن تجزیهنشده.
- html
- HTML
- raw
- کلید پیام و پارامترها.
- none
- بدون متن خروجی، فقط شناسههای خطا.
- bc
- قالب مورد استفاده تا پیش از مدیاویکی ۱.۲۹. از errorlang و errorsuselocal چشمپوشی میشود.
- یکی از مقدارهای زیر: bc، html، none، plaintext، raw، wikitext
- پیشفرض: bc
- errorlang
Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.
- پیشفرض: uselang
- errorsuselocal
در صورت وارد شدن، متن خطاها از پیامهای سفارشیسازیشدهٔ محلی از فضای نام مدیاویکی استفاده خواهند کرد.
- نوع: بولی (جزئیات)
- centralauthtoken
When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after ۶۰ seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).
On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.
- راهنما برای پودمان اصلی.
- api.php?action=help [باز کردن در صفحهٔ تمرین]
- همهٔ راهنماها در یک صفحه.
- api.php?action=help&recursivesubmodules=1 [باز کردن در صفحهٔ تمرین]
Data types
Input to MediaWiki should be NFC-normalized UTF-8. MediaWiki may attempt to convert other input, but this may cause some operations (such as edits with MD5 checks) to fail.
Parameters that take multiple values are normally submitted with the values separated using the pipe character, e.g. param=value1|value2 or param=value1%7Cvalue2. If a value must contain the pipe character, use U+001F (Unit Separator) as the separator and prefix the value with U+001F, e.g. param=%1Fvalue1%1Fvalue2.
Some parameter types in API requests need further explanation:
- boolean
Boolean parameters work like HTML checkboxes: if the parameter is specified, regardless of value, it is considered true. For a false value, omit the parameter entirely.
- expiry
Expiry values may be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). For no expiry, use infinite, indefinite, infinity or never.
- timestamp
Timestamps may be specified in several formats, see the Timestamp library input formats documented on mediawiki.org for details. ISO 8601 date and time is recommended: 2001-01-15T14:56:00Z. Additionally, the string now may be used to specify the current timestamp.
Templated parameters
Templated parameters support cases where an API module needs a value for each value of some other parameter. For example, if there were an API module to request fruit, it might have a parameter fruits to specify which fruits are being requested and a templated parameter {fruit}-quantity to specify how many of each fruit to request. An API client that wants 1 apple, 5 bananas, and 20 strawberries could then make a request like fruits=apples|bananas|strawberries&apples-quantity=1&bananas-quantity=5&strawberries-quantity=20.
اعتبار
API developers:
- Yuri Astrakhan (creator, lead developer Sep 2006–Sep 2007)
- Roan Kattouw (lead developer Sep 2007–2009)
- Victor Vasiliev
- Bryan Tong Minh
- Sam Reed
- Brad Jorsch (lead developer 2013–2020)
Please send your comments, suggestions and questions to mediawiki-api@lists.wikimedia.org or file a bug report at https://phabricator.wikimedia.org/.